Lineage for d1hdma2 (1hdm A:13-93)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) 
Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88807] (1 PDB entry) 
Domain d1hdma2: 1hdm A:13-93 [38157]
Other proteins in same PDB: d1hdma1, d1hdmb1, d1hdmb2
Details for d1hdma2
PDB Entry: 1hdm (more details), 2.5 Å
PDB Description: histocompatibility antigen hla-dm
PDB Compounds: (A:) protein (class II histocompatibility antigen, m alpha chain)SCOPe Domain Sequences for d1hdma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdma2 d.19.1.1 (A:13-93) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]}
lqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdailf
dkefcewmiqqipkldgkipv
SCOPe Domain Coordinates for d1hdma2:
Click to download the PDB-style file with coordinates for d1hdma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hdma2:
- d1hdma2 first appeared (with stable ids) in SCOP 1.55
- d1hdma2 appears in SCOPe 2.02
- d1hdma2 appears in SCOPe 2.04
- d1hdma2 appears in the current release, SCOPe 2.08
View in 3D
