Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) |
Protein Haloalkane dehalogenase [53514] (4 species) |
Species Xanthobacter autotrophicus [TaxId:280] [53515] (17 PDB entries) |
Domain d1hdea_: 1hde A: [34675] mutant |
PDB Entry: 1hde (more details), 2.7 Å
SCOPe Domain Sequences for d1hdea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdea_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} minairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgwtawkydlv tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar ealkhfaete
Timeline for d1hdea_: