Lineage for d1hd8a1 (1hd8 A:263-356)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 812053Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 812054Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (2 families) (S)
  5. 812055Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins)
  6. 812062Protein Penicillin-binding protein 5, C-terminal domain [69191] (1 species)
  7. 812063Species Escherichia coli [TaxId:562] [69192] (8 PDB entries)
  8. 812070Domain d1hd8a1: 1hd8 A:263-356 [65803]
    Other proteins in same PDB: d1hd8a2
    mutant

Details for d1hd8a1

PDB Entry: 1hd8 (more details), 2.3 Å

PDB Description: crystal structure of a deacylation-defective mutant of penicillin-binding protein 5 at 2.3 a resolution
PDB Compounds: (A:) penicillin-binding protein 5

SCOP Domain Sequences for d1hd8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hd8a1 b.105.1.1 (A:263-356) Penicillin-binding protein 5, C-terminal domain {Escherichia coli [TaxId: 562]}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipegn

SCOP Domain Coordinates for d1hd8a1:

Click to download the PDB-style file with coordinates for d1hd8a1.
(The format of our PDB-style files is described here.)

Timeline for d1hd8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hd8a2