Lineage for d1hd0a_ (1hd0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951910Protein Heterogeneous nuclear ribonucleoprotein d0 [54944] (1 species)
  7. 2951911Species Human (Homo sapiens) [TaxId:9606] [54945] (2 PDB entries)
  8. 2951912Domain d1hd0a_: 1hd0 A: [39188]
    RBD1

Details for d1hd0a_

PDB Entry: 1hd0 (more details)

PDB Description: heterogeneous nuclear ribonucleoprotein d0 (hnrnp d0 rbd1), nmr
PDB Compounds: (A:) protein (heterogeneous nuclear ribonucleoprotein d0)

SCOPe Domain Sequences for d1hd0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}
kmfigglswdttkkdlkdyfskfgevvdctlkldpitgrsrgfgfvlfkesesvdkvmdq
kehklngkvidpkra

SCOPe Domain Coordinates for d1hd0a_:

Click to download the PDB-style file with coordinates for d1hd0a_.
(The format of our PDB-style files is described here.)

Timeline for d1hd0a_: