Lineage for d1hcnb_ (1hcn B:)
- Root: SCOP 1.75
Class g: Small proteins [56992] (90 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
disulfide-rich fold; common core is all-betaSuperfamily g.17.1: Cystine-knot cytokines [57501] (7 families) 
Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins) 
Protein Gonadotropin B chain [63396] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63398] (3 PDB entries) 
Domain d1hcnb_: 1hcn B: [44810]
Other proteins in same PDB: d1hcna_
complexed with nag
Details for d1hcnb_
PDB Entry: 1hcn (more details), 2.6 Å
PDB Description: structure of human chorionic gonadotropin at 2.6 angstroms resolution from mad analysis of the selenomethionyl protein
PDB Compounds: (B:) human chorionic gonadotropinSCOP Domain Sequences for d1hcnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcnb_ g.17.1.4 (B:) Gonadotropin B chain {Human (Homo sapiens) [TaxId: 9606]}
keplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyrd
vrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcd
SCOP Domain Coordinates for d1hcnb_:
Click to download the PDB-style file with coordinates for d1hcnb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hcnb_:
- d1hcnb_ first appeared (with stable ids) in SCOP 1.55
- d1hcnb_ appears in SCOP 1.73
- d1hcnb_ appears in SCOPe 2.01
- d1hcnb_ appears in the current release, SCOPe 2.08
View in 3D
