Class g: Small proteins [56992] (90 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) |
Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins) |
Protein Gonadotropin B chain [63396] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63398] (3 PDB entries) |
Domain d1hcnb_: 1hcn B: [44810] Other proteins in same PDB: d1hcna_ complexed with nag |
PDB Entry: 1hcn (more details), 2.6 Å
SCOP Domain Sequences for d1hcnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcnb_ g.17.1.4 (B:) Gonadotropin B chain {Human (Homo sapiens) [TaxId: 9606]} keplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyrd vrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcd
Timeline for d1hcnb_: