Lineage for d1hc9a_ (1hc9 A:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.7: Snake toxin-like [57301] (1 superfamily)
disulfide-rich fold: nearly all-betaSuperfamily g.7.1: Snake toxin-like [57302] (4 families) 
Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
automatically mapped to Pfam PF00087
Protein Bungarotoxin [57324] (4 species) Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries) 
Domain d1hc9a_: 1hc9 A: [65786]
complexed with high affinity peptide
complexed with iod
Details for d1hc9a_
PDB Entry: 1hc9 (more details), 1.8 Å
PDB Description: alpha-bungarotoxin complexed with high affinity peptide
PDB Compounds: (A:) alpha-bungarotoxin isoform v31SCOPe Domain Sequences for d1hc9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hc9a_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg
SCOPe Domain Coordinates for d1hc9a_:
Click to download the PDB-style file with coordinates for d1hc9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hc9a_:
- d1hc9a_ first appeared in SCOP 1.59
- d1hc9a_ appears in SCOPe 2.07
View in 3D
