Lineage for d1hbka_ (1hbk A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764491Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764492Superfamily a.11.1: Acyl-CoA binding protein [47027] (1 family) (S)
  5. 764493Family a.11.1.1: Acyl-CoA binding protein [47028] (1 protein)
  6. 764494Protein Acyl-CoA binding protein [47029] (2 species)
  7. 764504Species Plasmodium falciparum [TaxId:5833] [63498] (1 PDB entry)
  8. 764505Domain d1hbka_: 1hbk A: [60887]
    complexed with coa, myr, ni

Details for d1hbka_

PDB Entry: 1hbk (more details), 2 Å

PDB Description: acyl-coa binding protein from plasmodium falciparum
PDB Compounds: (A:) acyl-coa binding protein

SCOP Domain Sequences for d1hbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]}
hmaqvfeecvsfinglprtinlpnelkldlykyykqstigncnikepsahkyidrkkyea
wksvenlnredaqkryvdivseifpywqd

SCOP Domain Coordinates for d1hbka_:

Click to download the PDB-style file with coordinates for d1hbka_.
(The format of our PDB-style files is described here.)

Timeline for d1hbka_: