Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species) |
Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [54605] (6 PDB entries) |
Domain d1hana2: 1han A:133-289 [38507] CASP1 complexed with fe, tbu |
PDB Entry: 1han (more details), 1.9 Å
SCOPe Domain Sequences for d1hana2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hana2 d.32.1.3 (A:133-289) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} avsgfltgeqglghfvrcvpdsdkalafytdvlgfqlsdvidmkmgpdvtvpayflhcne rhhtlaiaafplpkrihhfmlevaslddvgfafdrvdadglitstlgrhtndhmvsfyas tpsgveveygwsartvdrswvvvrhdspsmwghksvr
Timeline for d1hana2: