Lineage for d1ha6a_ (1ha6 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175411Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 2175466Species Mouse (Mus musculus), ccl20/mip-3a [TaxId:10090] [64214] (1 PDB entry)
  8. 2175467Domain d1ha6a_: 1ha6 A: [60875]

Details for d1ha6a_

PDB Entry: 1ha6 (more details)

PDB Description: nmr solution structure of murine ccl20/mip-3a chemokine
PDB Compounds: (A:) macrophage inflammatory protein 3 alpha

SCOPe Domain Sequences for d1ha6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha6a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Mouse (Mus musculus), ccl20/mip-3a [TaxId: 10090]}
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkrav
nllslrvkkm

SCOPe Domain Coordinates for d1ha6a_:

Click to download the PDB-style file with coordinates for d1ha6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ha6a_: