Lineage for d1ha0a2 (1ha0 A:330-502)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709417Protein Influenza hemagglutinin (stalk) [58066] (7 species)
    trimer
  7. 1709420Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)
  8. 1709568Domain d1ha0a2: 1ha0 A:330-502 [45697]
    Other proteins in same PDB: d1ha0a1
    complexed with nag

Details for d1ha0a2

PDB Entry: 1ha0 (more details), 2.8 Å

PDB Description: hemagglutinin precursor ha0
PDB Compounds: (A:) protein (hemagglutinin precursor)

SCOPe Domain Sequences for d1ha0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha0a2 h.3.1.1 (A:330-502) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrnealnnrfqi

SCOPe Domain Coordinates for d1ha0a2:

Click to download the PDB-style file with coordinates for d1ha0a2.
(The format of our PDB-style files is described here.)

Timeline for d1ha0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ha0a1