Lineage for d1ha0a1 (1ha0 A:9-329)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimersFamily b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) Protein Hemagglutinin [49824] (7 species)
includes rudiment esterase domainSpecies Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries) 
Domain d1ha0a1: 1ha0 A:9-329 [23824]
Other proteins in same PDB: d1ha0a2
complexed with nag
Details for d1ha0a1
PDB Entry: 1ha0 (more details), 2.8 Å
PDB Description: hemagglutinin precursor ha0
PDB Compounds: (A:) protein (hemagglutinin precursor)SCOPe Domain Sequences for d1ha0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha0a1 b.19.1.2 (A:9-329) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpekqtq
SCOPe Domain Coordinates for d1ha0a1:
Click to download the PDB-style file with coordinates for d1ha0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ha0a1:
- d1ha0a1 first appeared (with stable ids) in SCOP 1.55
- d1ha0a1 appears in SCOPe 2.04
- d1ha0a1 appears in SCOPe 2.06
- d1ha0a1 appears in the current release, SCOPe 2.08
View in 3D
