| Class b: All beta proteins [48724] (177 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50077] (5 PDB entries) |
| Domain d1h92a_: 1h92 A: [65741] |
PDB Entry: 1h92 (more details)
SCOPe Domain Sequences for d1h92a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h92a_ b.34.2.1 (A:) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
gsplqdnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfva
kan
Timeline for d1h92a_: