Lineage for d1h8ta_ (1h8t A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1812436Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1812437Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 1812457Protein Human enterovirus B coat proteins [88635] (4 species)
  7. 1812471Species Human echovirus 11 [TaxId:12078] [74890] (3 PDB entries)
  8. 1812473Domain d1h8ta_: 1h8t A: [70920]
    complexed with doa, myr

Details for d1h8ta_

PDB Entry: 1h8t (more details), 2.9 Å

PDB Description: Echovirus 11
PDB Compounds: (A:) echovirus 11 coat protein vp1

SCOPe Domain Sequences for d1h8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ta_ b.121.4.1 (A:) Human enterovirus B coat proteins {Human echovirus 11 [TaxId: 12078]}
gdvveavenavarvadtigsgpsnsqavpaltavetghtsqvtpsdtvqtrhvknyhsrs
essienflsrsacvymgeyhttnsdqtklfaswtisarrmvqmrrkleiftyvrfdvevt
fvitskqdqgtqlgqdmpplthqimyippggpipksvtdytwqtstnpsifwtegnappr
msipfisignaysnfydgwshfsqngvygyntlnhmgqiyvrhvngssplpmtstvrmyf
kpkhvkawvprpprlcqyknastvnfsptditdkrnsityipdtvkpdvs

SCOPe Domain Coordinates for d1h8ta_:

Click to download the PDB-style file with coordinates for d1h8ta_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ta_: