Lineage for d1h8sb2 (1h8s B:133-243)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288122Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (177 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1288212Domain d1h8sb2: 1h8s B:133-243 [60792]
    Other proteins in same PDB: d1h8sa1, d1h8sb1
    part of anti-ampicillin scFv
    complexed with aic, so4; mutant

Details for d1h8sb2

PDB Entry: 1h8s (more details), 2.4 Å

PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment complexed with the hapten.
PDB Compounds: (B:) mutant al2 6e7p9g

SCOPe Domain Sequences for d1h8sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8sb2 b.1.1.1 (B:133-243) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlqepggelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytnyn
qkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvsa

SCOPe Domain Coordinates for d1h8sb2:

Click to download the PDB-style file with coordinates for d1h8sb2.
(The format of our PDB-style files is described here.)

Timeline for d1h8sb2:

1288212
d1h8sb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1h8sb1