Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.4: SNARE-like [64356] (5 families) beta(2)-alpha-beta(3)-alpha(2) |
Family d.110.4.1: Synatpobrevin N-terminal domain [64357] (3 proteins) |
Protein Synaptobrevin homolog 1 ykt6 [64360] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64361] (2 PDB entries) |
Domain d1h8ma_: 1h8m A: [60782] |
PDB Entry: 1h8m (more details)
SCOPe Domain Sequences for d1h8ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ma_ d.110.4.1 (A:) Synaptobrevin homolog 1 ykt6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mriyyigvfrsggekalelsevkdlsqfgfferssvgqfmtffaetvasrtgagerqsie egnyighvyarsegicgvlitdkqypvrpaytllnkildeylvahpkeewadvtetndal kmkqldtyiskyqdpsqada
Timeline for d1h8ma_: