Lineage for d1h8ma_ (1h8m A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2211132Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 2211133Family d.110.4.1: Synatpobrevin N-terminal domain [64357] (3 proteins)
  6. 2211138Protein Synaptobrevin homolog 1 ykt6 [64360] (1 species)
  7. 2211139Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64361] (2 PDB entries)
  8. 2211140Domain d1h8ma_: 1h8m A: [60782]

Details for d1h8ma_

PDB Entry: 1h8m (more details)

PDB Description: solution structure of ykt6
PDB Compounds: (A:) synaptobrevin homolog 1

SCOPe Domain Sequences for d1h8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ma_ d.110.4.1 (A:) Synaptobrevin homolog 1 ykt6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mriyyigvfrsggekalelsevkdlsqfgfferssvgqfmtffaetvasrtgagerqsie
egnyighvyarsegicgvlitdkqypvrpaytllnkildeylvahpkeewadvtetndal
kmkqldtyiskyqdpsqada

SCOPe Domain Coordinates for d1h8ma_:

Click to download the PDB-style file with coordinates for d1h8ma_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ma_: