Class b: All beta proteins [48724] (174 folds) |
Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily) pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns |
Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) |
Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein) |
Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species) delta subunit in mitochondria |
Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries) |
Domain d1h8eh_: 1h8e H: [60757] Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8ei_ the rest of subunit structure is disordered complexed with adp, alf, gol, mg, so4 |
PDB Entry: 1h8e (more details), 2 Å
SCOP Domain Sequences for d1h8eh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8eh_ b.93.1.1 (H:) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} qmsftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttsk yfvssgsvtvnadssvqllaeeavtldml
Timeline for d1h8eh_: