Lineage for d1h88b_ (1h88 B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644061Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 2644062Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 2644093Protein C/ebp beta [57985] (2 species)
  7. 2644094Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)
  8. 2644108Domain d1h88b_: 1h88 B: [65720]
    Other proteins in same PDB: d1h88c1, d1h88c2, d1h88c3
    protein/DNA complex; complexed with nh4

Details for d1h88b_

PDB Entry: 1h88 (more details), 2.8 Å

PDB Description: crystal structure of ternary protein-dna complex1
PDB Compounds: (B:) ccaat/enhancer binding protein beta

SCOPe Domain Sequences for d1h88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h88b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
tvdkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrels
tlrnlfkqlpe

SCOPe Domain Coordinates for d1h88b_:

Click to download the PDB-style file with coordinates for d1h88b_.
(The format of our PDB-style files is described here.)

Timeline for d1h88b_: