| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
| Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
| Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [51411] (9 PDB entries) |
| Domain d1h7xb2: 1h7x B:533-844 [28633] Other proteins in same PDB: d1h7xa1, d1h7xa3, d1h7xa4, d1h7xa5, d1h7xb1, d1h7xb3, d1h7xb4, d1h7xb5, d1h7xc1, d1h7xc3, d1h7xc4, d1h7xc5, d1h7xd1, d1h7xd3, d1h7xd4, d1h7xd5 complexed with fad, fmn, ndp, sf4, urf; mutant has additional subdomain(s) that are not in the common domain has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1h7x (more details), 2.01 Å
SCOPe Domain Sequences for d1h7xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7xb2 c.1.4.1 (B:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlsaphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie
Timeline for d1h7xb2:
View in 3DDomains from same chain: (mouse over for more information) d1h7xb1, d1h7xb3, d1h7xb4, d1h7xb5 |