Lineage for d1h70a_ (1h70 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668076Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1668077Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1668103Family d.126.1.3: Dimethylarginine dimethylaminohydrolase DDAH [64380] (1 protein)
    functionally related to the amidinotransferase, similar active sites
    automatically mapped to Pfam PF02274
  6. 1668104Protein Dimethylarginine dimethylaminohydrolase DDAH [64381] (1 species)
  7. 1668105Species Pseudomonas aeruginosa [TaxId:287] [64382] (3 PDB entries)
  8. 1668106Domain d1h70a_: 1h70 A: [60711]
    complexed with cir; mutant

Details for d1h70a_

PDB Entry: 1h70 (more details), 1.8 Å

PDB Description: ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline
PDB Compounds: (A:) ng, ng-dimethylarginine dimethylaminohydrolase

SCOPe Domain Sequences for d1h70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h70a_ d.126.1.3 (A:) Dimethylarginine dimethylaminohydrolase DDAH {Pseudomonas aeruginosa [TaxId: 287]}
fmfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfp
dsvfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdim
mvgdhfyigesartnaegarqmiailekhglsgsvvrlekvlhlktglaylehnnllaag
efvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtse
yrkidggvssmslrf

SCOPe Domain Coordinates for d1h70a_:

Click to download the PDB-style file with coordinates for d1h70a_.
(The format of our PDB-style files is described here.)

Timeline for d1h70a_: