Lineage for d1h6ua1 (1h6u A:263-343)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
truncated fold fused to an LRR domain
Protein Internalin H [69174] (1 species) Species Listeria monocytogenes [TaxId:1639] [69175] (1 PDB entry) 
Domain d1h6ua1: 1h6u A:263-343 [65688]
Other proteins in same PDB: d1h6ua2
Details for d1h6ua1
PDB Entry: 1h6u (more details), 1.8 Å
PDB Description: internalin h: crystal structure of fused n-terminal domains.
PDB Compounds: (A:) internalin hSCOPe Domain Sequences for d1h6ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ua1 b.1.18.15 (A:263-343) Internalin H {Listeria monocytogenes [TaxId: 1639]}
titnqpvfynnnlvvpnvvkgpsgapiapatisdngtyaspnltwnltsfinnvsytfnq
svtfknttvpfsgtvtqplte
SCOPe Domain Coordinates for d1h6ua1:
Click to download the PDB-style file with coordinates for d1h6ua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h6ua1:
- d1h6ua1 first appeared in SCOP 1.59
- d1h6ua1 appears in SCOPe 2.03
- d1h6ua1 appears in SCOPe 2.05
- d1h6ua1 appears in the current release, SCOPe 2.08
View in 3D
