| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins) truncated fold fused to an LRR domain |
| Protein Internalin H [69174] (1 species) |
| Species Listeria monocytogenes [TaxId:1639] [69175] (1 PDB entry) |
| Domain d1h6ua1: 1h6u A:263-343 [65688] Other proteins in same PDB: d1h6ua2 |
PDB Entry: 1h6u (more details), 1.8 Å
SCOPe Domain Sequences for d1h6ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ua1 b.1.18.15 (A:263-343) Internalin H {Listeria monocytogenes [TaxId: 1639]}
titnqpvfynnnlvvpnvvkgpsgapiapatisdngtyaspnltwnltsfinnvsytfnq
svtfknttvpfsgtvtqplte
Timeline for d1h6ua1: