Lineage for d1h4ib_ (1h4i B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346747Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 2346748Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 2346749Protein Methanol dehydrogenase, light chain [48668] (3 species)
  7. 2346750Species Methylobacterium extorquens [TaxId:408] [63633] (3 PDB entries)
    Uniprot P14775
  8. 2346753Domain d1h4ib_: 1h4i B: [60587]
    Other proteins in same PDB: d1h4ia_, d1h4ic_
    complexed with ca, pqq

Details for d1h4ib_

PDB Entry: 1h4i (more details), 1.94 Å

PDB Description: methylobacterium extorquens methanol dehydrogenase
PDB Compounds: (B:) methanol dehydrogenase subunit 2

SCOPe Domain Sequences for d1h4ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4ib_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylobacterium extorquens [TaxId: 408]}
ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
tgkfeydvakisa

SCOPe Domain Coordinates for d1h4ib_:

Click to download the PDB-style file with coordinates for d1h4ib_.
(The format of our PDB-style files is described here.)

Timeline for d1h4ib_: