![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) ![]() consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
![]() | Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
![]() | Protein Methanol dehydrogenase, light chain [48668] (3 species) |
![]() | Species Methylobacterium extorquens [TaxId:408] [63633] (3 PDB entries) Uniprot P14775 |
![]() | Domain d1h4ib_: 1h4i B: [60587] Other proteins in same PDB: d1h4ia_, d1h4ic_ complexed with ca, pqq |
PDB Entry: 1h4i (more details), 1.94 Å
SCOPe Domain Sequences for d1h4ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4ib_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylobacterium extorquens [TaxId: 408]} ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk tgkfeydvakisa
Timeline for d1h4ib_: