Lineage for d1h4ba_ (1h4b A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1490676Family a.39.1.10: Polcalcin [89048] (3 proteins)
    calcium-binding pollen allergen; two EF-hands per subunit
  6. 1490677Protein Polcalcin bet v 4 [101177] (1 species)
  7. 1490678Species White birch (Betula verrucosa) [TaxId:3505] [101178] (1 PDB entry)
  8. 1490679Domain d1h4ba_: 1h4b A: [90608]
    monomeric solution structure
    complexed with ca

Details for d1h4ba_

PDB Entry: 1h4b (more details)

PDB Description: solution structure of the birch pollen allergen bet v 4
PDB Compounds: (A:) polcalcin bet v 4

SCOPe Domain Sequences for d1h4ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4ba_ a.39.1.10 (A:) Polcalcin bet v 4 {White birch (Betula verrucosa) [TaxId: 3505]}
addhpqdkaererifkrfdangdgkisaaelgealktlgsitpdevkhmmaeidtdgdgf
isfqeftdfgranrgllkdvakif

SCOPe Domain Coordinates for d1h4ba_:

Click to download the PDB-style file with coordinates for d1h4ba_.
(The format of our PDB-style files is described here.)

Timeline for d1h4ba_: