| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.10: Polcalcin [89048] (3 proteins) calcium-binding pollen allergen; two EF-hands per subunit |
| Protein Polcalcin bet v 4 [101177] (1 species) |
| Species White birch (Betula verrucosa) [TaxId:3505] [101178] (1 PDB entry) |
| Domain d1h4ba_: 1h4b A: [90608] monomeric solution structure complexed with ca |
PDB Entry: 1h4b (more details)
SCOPe Domain Sequences for d1h4ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4ba_ a.39.1.10 (A:) Polcalcin bet v 4 {White birch (Betula verrucosa) [TaxId: 3505]}
addhpqdkaererifkrfdangdgkisaaelgealktlgsitpdevkhmmaeidtdgdgf
isfqeftdfgranrgllkdvakif
Timeline for d1h4ba_: