Lineage for d1h3ph2 (1h3p H:114-216)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 785070Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 785379Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele)
    Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
    Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form
    Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region
    Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region
    Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele
    SQ NA # part of Fab 28 against HIV-1 RT
    Uniprot P01868 #
    GC1_MOUSE Ig gamma-1 chain C region secreted form
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 785750Domain d1h3ph2: 1h3p H:114-216 [76649]
    Other proteins in same PDB: d1h3ph1, d1h3pl1, d1h3pl2

Details for d1h3ph2

PDB Entry: 1h3p (more details), 2.6 Å

PDB Description: structural characterisation of a monoclonal antibody specific for the pres1 region of the hepatitis b virus
PDB Compounds: (H:) antibody fab fragment

SCOP Domain Sequences for d1h3ph2:

Sequence, based on SEQRES records: (download)

>d1h3ph2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgslaqtnsmvtlgclvkgyfpepvtvtwnsgslsssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Sequence, based on observed residues (ATOM records): (download)

>d1h3ph2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsnsmvtlgclvkgyfpepvtvtwnsgslsssgvhtfpavlqsdlyt
lsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1h3ph2:

Click to download the PDB-style file with coordinates for d1h3ph2.
(The format of our PDB-style files is described here.)

Timeline for d1h3ph2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3ph1