![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Cyclomaltodextrinase [101917] (1 species) protein shares similar domain organization with maltogenic amylases but differs in the spatial arrangement of its domains |
![]() | Species Flavobacterium sp. 92 [TaxId:197856] [101918] (1 PDB entry) |
![]() | Domain d1h3ga2: 1h3g A:518-600 [90595] Other proteins in same PDB: d1h3ga1, d1h3ga3, d1h3gb1, d1h3gb3 complexed with ca |
PDB Entry: 1h3g (more details), 2.1 Å
SCOPe Domain Sequences for d1h3ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3ga2 b.71.1.1 (A:518-600) Cyclomaltodextrinase {Flavobacterium sp. 92 [TaxId: 197856]} rlmhfgpeentwvyfrynkdkrimvamnnndkpmtlptarfqemlkgapsgvdflsgktv glgrelrlapksvvvielpglpe
Timeline for d1h3ga2: