Lineage for d1h3ga1 (1h3g A:6-95)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765303Protein Cyclomaltodextrinase, N-terminal domain [101523] (1 species)
    protein shares similar domain organization with maltogenic amylases but differs in the spatial arrangement of its domains
  7. 2765304Species Flavobacterium sp. 92 [TaxId:197856] [101524] (1 PDB entry)
  8. 2765305Domain d1h3ga1: 1h3g A:6-95 [90594]
    Other proteins in same PDB: d1h3ga2, d1h3ga3, d1h3ga4, d1h3gb2, d1h3gb3, d1h3gb4
    complexed with ca

Details for d1h3ga1

PDB Entry: 1h3g (more details), 2.1 Å

PDB Description: cyclomaltodextrinase from flavobacterium sp. no. 92: from dna sequence to protein structure
PDB Compounds: (A:) cyclomaltodextrinase

SCOPe Domain Sequences for d1h3ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ga1 b.1.18.2 (A:6-95) Cyclomaltodextrinase, N-terminal domain {Flavobacterium sp. 92 [TaxId: 197856]}
iehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfvdleig
peaqpgsfdivfkgdgrseryryrllareq

SCOPe Domain Coordinates for d1h3ga1:

Click to download the PDB-style file with coordinates for d1h3ga1.
(The format of our PDB-style files is described here.)

Timeline for d1h3ga1: