Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64275] (6 PDB entries) |
Domain d1h2ux_: 1h2u X: [76590] Other proteins in same PDB: d1h2ua1, d1h2ua2, d1h2ua3, d1h2ub1, d1h2ub2, d1h2ub3 protein/RNA complex; complexed with 7mg, gdp |
PDB Entry: 1h2u (more details), 2.4 Å
SCOPe Domain Sequences for d1h2ux_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2ux_ d.58.7.1 (X:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} gllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsks gdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegr qygrgrsggqvrdeyrqdydagrggygkl
Timeline for d1h2ux_: