Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries) Uniprot P20248 175-432 |
Domain d1h27b1: 1h27 B:175-309 [76535] Other proteins in same PDB: d1h27a1, d1h27a2, d1h27c1, d1h27c2 |
PDB Entry: 1h27 (more details), 2.2 Å
SCOPe Domain Sequences for d1h27b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h27b1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm ehlvlkvltfdlaap
Timeline for d1h27b1: