|  | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) | 
|  | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet | 
|  | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)  | 
|  | Family d.109.1.1: Gelsolin-like [55754] (5 proteins) | 
|  | Protein Gelsolin [55759] (2 species) consists of six similar domains | 
|  | Species Human (Homo sapiens) [TaxId:9606] [55761] (30 PDB entries) Uniprot P20065 55-179 | 
|  | Domain d1h1vg3: 1h1v G:629-742 [76505] Other proteins in same PDB: d1h1va1, d1h1va2 domains 4, 5 and 6 complexed with atp, ca | 
PDB Entry: 1h1v (more details), 3 Å
SCOPe Domain Sequences for d1h1vg3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1vg3 d.109.1.1 (G:629-742) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds
qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddyws
Timeline for d1h1vg3: