SCOPe 2.08: Domain d1h1pb2: 1h1p B:310-432

Lineage for d1h1pb2 (1h1p B:310-432)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the others
Superfamily a.74.1: Cyclin-like [47954] (4 families)
duplication: consists of two domains of this fold
Family a.74.1.1: Cyclin [47955] (9 proteins)
Protein Cyclin A [47956] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
Uniprot P20248 175-432
Domain d1h1pb2: 1h1p B:310-432 [76479]
Other proteins in same PDB: d1h1pa1, d1h1pa2, d1h1pc1, d1h1pc2
complexed with cmg

Details for d1h1pb2

PDB Entry: 1h1p (more details), 2.1 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu2058

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1h1pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1pb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d1h1pb2:

Click to download the PDB-style file with coordinates for d1h1pb2.
(The format of our PDB-style files is described here.)

Timeline for d1h1pb2: