Lineage for d1h0hb_ (1h0h B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949433Protein Tungsten containing formate dehydrogenase, small subunit [82664] (1 species)
  7. 2949434Species Desulfovibrio gigas [TaxId:879] [82665] (1 PDB entry)
  8. 2949435Domain d1h0hb_: 1h0h B: [76437]
    Other proteins in same PDB: d1h0ha1, d1h0ha2, d1h0hk1, d1h0hk2
    complexed with 2md, ca, epe, mgd, sf4, unx, w

Details for d1h0hb_

PDB Entry: 1h0h (more details), 1.8 Å

PDB Description: tungsten containing formate dehydrogenase from desulfovibrio gigas
PDB Compounds: (B:) formate dehydrogenase subunit beta

SCOPe Domain Sequences for d1h0hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]}
skgffvdttrctacrgcqvackqwhgnpatptentgfhqnppdfnfhtyklvrmheqeid
gridwlffpdqcrhciappckatadmedesaiihddatgcvlftpktkdledyesvisac
pydvprkvaesnqmakcdmcidritnglrpacvtscptgamnfgdlsemeamasarlaei
kaaysdaklcdpddvrvifltahnpklyheyava

SCOPe Domain Coordinates for d1h0hb_:

Click to download the PDB-style file with coordinates for d1h0hb_.
(The format of our PDB-style files is described here.)

Timeline for d1h0hb_: