Lineage for d1h09a2 (1h09 A:2-190)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (4 proteins)
Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
permutation of the common fold; strand 8 is antiparallel to the rest of the barrel- Protein N-terminal domain of endolysin [89484] (1 species)
- Species Bacteriophage cp-1 [TaxId:10747] [89485] (2 PDB entries)
Domain d1h09a2: 1h09 A:2-190 [83421]
Other proteins in same PDB: d1h09a1
Details for d1h09a2
PDB Entry: 1h09 (more details), 2.1 Å
PDB Description: multimodular pneumococcal cell wall endolysin from phage cp-1
PDB Compounds: (A:) lysozymeSCOPe Domain Sequences for d1h09a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h09a2 c.1.8.8 (A:2-190) N-terminal domain of endolysin {Bacteriophage cp-1 [TaxId: 10747]}
vkkndlfvdvsshngyditgileqmgttntiikisesttylnpclsaqveqsnpigfyhf
arfggdvaeaereaqffldnvpmqvkylvldyeddpsgdaqantnaclrfmqmiadagyk
piyysykpfthdnvdyqqilaqfpnslwiagyglndgtanfeyfpsmdgirwwqyssnpf
dknivlldd
SCOPe Domain Coordinates for d1h09a2:
Click to download the PDB-style file with coordinates for d1h09a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h09a2:
- d1h09a2 first appeared in SCOP 1.65
- d1h09a2 appears in SCOPe 2.07
View in 3D
