Class g: Small proteins [56992] (98 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries) |
Domain d1h03p2: 1h03 P:67-129 [83412] modules 3 and 4 |
PDB Entry: 1h03 (more details), 1.7 Å
SCOPe Domain Sequences for d1h03p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe crg
Timeline for d1h03p2: