Lineage for d1h03p2 (1h03 P:67-129)
- Root: SCOP 1.75
Class g: Small proteins [56992] (90 folds) 
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
disulfide-rich all-beta foldSuperfamily g.18.1: Complement control module/SCR domain [57535] (1 family) 
Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
Pfam PF00084
Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species) Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries) 
Domain d1h03p2: 1h03 P:67-129 [83412]
modules 3 and 4
Details for d1h03p2
PDB Entry: 1h03 (more details), 1.7 Å
PDB Description: human cd55 domains 3 & 4
PDB Compounds: (P:) complement decay-accelerating factorSCOP Domain Sequences for d1h03p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crg
SCOP Domain Coordinates for d1h03p2:
Click to download the PDB-style file with coordinates for d1h03p2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h03p2:
- d1h03p2 first appeared in SCOP 1.65
- d1h03p2 appears in SCOP 1.73
- d1h03p2 appears in SCOPe 2.01
- d1h03p2 appears in the current release, SCOPe 2.08
View in 3D
