Lineage for d1gzqa1 (1gzq A:184-280)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein CD1, alpha-3 domain [88615] (5 species) Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (4 PDB entries) 
Domain d1gzqa1: 1gzq A:184-280 [70818]
Other proteins in same PDB: d1gzqa2, d1gzqb_
complexed with d12, no3, pii, twt
Details for d1gzqa1
PDB Entry: 1gzq (more details), 2.26 Å
PDB Description: cd1b in complex with phophatidylinositol
PDB Compounds: (A:) T-cell surface glycoprotein cd1bSCOPe Domain Sequences for d1gzqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gzqa1 b.1.1.2 (A:184-280) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywgpg
SCOPe Domain Coordinates for d1gzqa1:
Click to download the PDB-style file with coordinates for d1gzqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gzqa1:
- d1gzqa1 first appeared in SCOP 1.61
- d1gzqa1 appears in SCOPe 2.02
- d1gzqa1 appears in SCOPe 2.04
- d1gzqa1 appears in the current release, SCOPe 2.08
View in 3D
