Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein CD1, alpha-3 domain [88615] (5 species) |
Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (10 PDB entries) |
Domain d1gzqa1: 1gzq A:184-279 [70818] Other proteins in same PDB: d1gzqa2, d1gzqa3, d1gzqb2, d1gzqb3 complexed with d12, no3, pii, twt |
PDB Entry: 1gzq (more details), 2.26 Å
SCOPe Domain Sequences for d1gzqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gzqa1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]} qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw ylratldvadgeaaglscrvkhsslegqdiilywgp
Timeline for d1gzqa1: