Lineage for d1gzpa2 (1gzp A:4-183)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
Class I MHC-related
Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (6 PDB entries) 
Domain d1gzpa2: 1gzp A:4-183 [70816]
Other proteins in same PDB: d1gzpa1, d1gzpb_
complexed with d12, gm2, twt
Details for d1gzpa2
PDB Entry: 1gzp (more details), 2.8 Å
PDB Description: cd1b in complex with gm2 ganglioside
PDB Compounds: (A:) T-cell surface glycoprotein cd1bSCOPe Domain Sequences for d1gzpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gzpa2 d.19.1.1 (A:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev
aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf
lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr
SCOPe Domain Coordinates for d1gzpa2:
Click to download the PDB-style file with coordinates for d1gzpa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gzpa2:
- d1gzpa2 first appeared in SCOP 1.61
- d1gzpa2 appears in SCOPe 2.03
- d1gzpa2 appears in SCOPe 2.05
- d1gzpa2 appears in the current release, SCOPe 2.08
View in 3D
