Lineage for d1gyfa_ (1gyf A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420381Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1420382Superfamily d.76.1: GYF domain [55277] (1 family) (S)
  5. 1420383Family d.76.1.1: GYF domain [55278] (2 proteins)
    Pfam PF02213
  6. 1420384Protein GYF domain from cd2bp2 protein [55279] (1 species)
  7. 1420385Species Human (Homo sapiens) [TaxId:9606] [55280] (3 PDB entries)
  8. 1420390Domain d1gyfa_: 1gyf A: [39749]

Details for d1gyfa_

PDB Entry: 1gyf (more details)

PDB Description: gyf domain from human cd2bp2 protein
PDB Compounds: (A:) protein (cytoplasmic domain binding protein (cd2bp2))

SCOPe Domain Sequences for d1gyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyfa_ d.76.1.1 (A:) GYF domain from cd2bp2 protein {Human (Homo sapiens) [TaxId: 9606]}
dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
yt

SCOPe Domain Coordinates for d1gyfa_:

Click to download the PDB-style file with coordinates for d1gyfa_.
(The format of our PDB-style files is described here.)

Timeline for d1gyfa_: