| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Laccase, N-terminal domain [418905] (5 species) |
| Species Trametes versicolor, laccase 2 [TaxId:5325] [419319] (1 PDB entry) |
| Domain d1gyca1: 1gyc A:1-130 [70748] Other proteins in same PDB: d1gyca2, d1gyca3 complexed with cu, ipa, nag |
PDB Entry: 1gyc (more details), 1.9 Å
SCOPe Domain Sequences for d1gyca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyca1 b.6.1.3 (A:1-130) Laccase, N-terminal domain {Trametes versicolor, laccase 2 [TaxId: 5325]}
aigpaaslvvanapvspdgflrdaivvngvfpsplitgkkgdrfqlnvvdtltnhtmlks
tsihwhgffqagtnwadgpafvnqcpiasghsflydfhvpdqagtfwyhshlstqycdgl
rgpfvvydpk
Timeline for d1gyca1: