![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.97: Cytolysin/lectin [63723] (1 superfamily) sandwich, 10 strands in 2 sheets; |
![]() | Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) ![]() some topological similarity to osmotin |
![]() | Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins) Pfam PF06369 |
![]() | Protein Sticholysin II [89268] (1 species) |
![]() | Species Carribean sea anemone (Stoichactis helianthus) [TaxId:6123] [89269] (6 PDB entries) |
![]() | Domain d1gwya_: 1gwy A: [83356] complexed with so4 |
PDB Entry: 1gwy (more details), 1.71 Å
SCOPe Domain Sequences for d1gwya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gwya_ b.97.1.1 (A:) Sticholysin II {Carribean sea anemone (Stoichactis helianthus) [TaxId: 6123]} alagtiiagasltfqvldkvleelgkvsrkiavgidnesggtwtalnayfrsgttdvilp efvpntkallysgrkdtgpvatgavaafayymssgntlgvmfsvpfdynwysnwwdvkiy sgkrradqgmyedlyygnpyrgdngwheknlgyglrmkgimtsageakmqikisr
Timeline for d1gwya_: