Lineage for d1gwxa_ (1gwx A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) 
Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48527] (34 PDB entries) 
Domain d1gwxa_: 1gwx A: [19327]
complexed with 433
Details for d1gwxa_
PDB Entry: 1gwx (more details), 2.5 Å
PDB Description: molecular recognition of fatty acids by peroxisome proliferator-activated receptors
PDB Compounds: (A:) protein (ppar-delta)SCOPe Domain Sequences for d1gwxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gwxa_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
tehaqmmqrikktetetslhpllqeiykdmy
SCOPe Domain Coordinates for d1gwxa_:
Click to download the PDB-style file with coordinates for d1gwxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gwxa_:
View in 3D
