Class a: All alpha proteins [46456] (290 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
Protein 16-heme cytochrome c HmcA [81940] (1 species) tandem repeat of four cytochrome c3-like domains |
Species Desulfovibrio vulgaris [TaxId:881] [81941] (3 PDB entries) |
Domain d1gwsa_: 1gws A: [76370] complexed with hec multiple common domains: applies to families that are inconsistently divided into domains |
PDB Entry: 1gws (more details), 2.4 Å
SCOPe Domain Sequences for d1gwsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gwsa_ a.138.1.1 (A:) 16-heme cytochrome c HmcA {Desulfovibrio vulgaris [TaxId: 881]} kradlieigamerfgkldlpkvafrhdqhttavtgmgkdcaachkskdgkmslkfmrldd nsaaelkeiyhancigchtdlakagkktgpqdgecrschnpkpsaasswkeigfdkslhy rhvaskaikpvgdpqkncgachhvydeaskklvwgknkedscrachgekpvdkrpaldta ahtacischmdvaktkaetgpvncagchapeaqakfkvvrevprldrgqpdaalilpvpg kdapremkgtmkpvafdhkaheakandcrtchhvridtctachtvngtadskfvqlekam hqpdsmrscvgchntrvqqptcagchgfikptksdaqcgvchvaapgfdakqveagalln lkaeqrsqvaasmlsarpqpkgtfdlndipekvvigsiakeyqpsefphrkivktliagi gedklaatfhiekgtlcqgchhnspasltppkcaschgkpfdadrgdrpglkaayhqqcm gchdrmkiekpantacvdchker
Timeline for d1gwsa_: