Lineage for d1gwsa_ (1gws A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734167Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2734168Protein 16-heme cytochrome c HmcA [81940] (1 species)
    tandem repeat of four cytochrome c3-like domains
  7. 2734169Species Desulfovibrio vulgaris [TaxId:881] [81941] (3 PDB entries)
  8. 2734171Domain d1gwsa_: 1gws A: [76370]
    complexed with hec
    multiple common domains: applies to families that are inconsistently divided into domains

Details for d1gwsa_

PDB Entry: 1gws (more details), 2.4 Å

PDB Description: hexadecaheme high molecular weight cytochrome hmc from desulfovibrio vulgaris hildenborough
PDB Compounds: (A:) high-molecular-weight cytochrome c

SCOPe Domain Sequences for d1gwsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwsa_ a.138.1.1 (A:) 16-heme cytochrome c HmcA {Desulfovibrio vulgaris [TaxId: 881]}
kradlieigamerfgkldlpkvafrhdqhttavtgmgkdcaachkskdgkmslkfmrldd
nsaaelkeiyhancigchtdlakagkktgpqdgecrschnpkpsaasswkeigfdkslhy
rhvaskaikpvgdpqkncgachhvydeaskklvwgknkedscrachgekpvdkrpaldta
ahtacischmdvaktkaetgpvncagchapeaqakfkvvrevprldrgqpdaalilpvpg
kdapremkgtmkpvafdhkaheakandcrtchhvridtctachtvngtadskfvqlekam
hqpdsmrscvgchntrvqqptcagchgfikptksdaqcgvchvaapgfdakqveagalln
lkaeqrsqvaasmlsarpqpkgtfdlndipekvvigsiakeyqpsefphrkivktliagi
gedklaatfhiekgtlcqgchhnspasltppkcaschgkpfdadrgdrpglkaayhqqcm
gchdrmkiekpantacvdchker

SCOPe Domain Coordinates for d1gwsa_:

Click to download the PDB-style file with coordinates for d1gwsa_.
(The format of our PDB-style files is described here.)

Timeline for d1gwsa_: