![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Laccase [49557] (5 species) consists of three domains of this fold |
![]() | Species Melanocarpus albomyces [TaxId:204285] [74873] (3 PDB entries) |
![]() | Domain d1gw0a3: 1gw0 A:344-559 [70625] |
PDB Entry: 1gw0 (more details), 2.4 Å
SCOP Domain Sequences for d1gw0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw0a3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad lrqrisqededdfnrvcdewraywptnpypkidsgl
Timeline for d1gw0a3: