Lineage for d1gw0a1 (1gw0 A:1-162)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660887Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 660933Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 660941Species Melanocarpus albomyces [TaxId:204285] [74873] (3 PDB entries)
  8. 660954Domain d1gw0a1: 1gw0 A:1-162 [70623]

Details for d1gw0a1

PDB Entry: 1gw0 (more details), 2.4 Å

PDB Description: crystal structure of laccase from melanocarpus albomyces in four copper form
PDB Compounds: (A:) laccase

SCOP Domain Sequences for d1gw0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw0a1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]}
eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslp

SCOP Domain Coordinates for d1gw0a1:

Click to download the PDB-style file with coordinates for d1gw0a1.
(The format of our PDB-style files is described here.)

Timeline for d1gw0a1: