Lineage for d1gvmb_ (1gvm B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.109: beta-hairpin stack [69359] (1 superfamily)
    Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn
  4. Superfamily b.109.1: Cell wall binding repeat [69360] (1 family) (S)
  5. Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins)
  6. Protein Choline binding domain of autolysin C-LytA [69362] (1 species)
  7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [69363] (4 PDB entries)
  8. Domain d1gvmb_: 1gvm B: [70613]
    complexed with cht, ddq, trs

Details for d1gvmb_

PDB Entry: 1gvm (more details), 2.8 Å

PDB Description: choline binding domain of the major autolysin (c-lyta) from streptococcus pneumoniae
PDB Compounds: (B:) autolysin

SCOPe Domain Sequences for d1gvmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvmb_ b.109.1.1 (B:) Choline binding domain of autolysin C-LytA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
givhsdgsypkdkfekingtwyyfdssgymladrwrkhtdgnwywfdnsgematgwkkia
dkwyyfneegamktgwvkykdtwyyldakegamvsnafiqsadgtgwyylkpdgtladrp
eftvepdglitvk

SCOPe Domain Coordinates for d1gvmb_ are not available.

Timeline for d1gvmb_:

Domains from other chains:
(mouse over for more information)
d1gvma_, d1gvmc_, d1gvmd_, d1gvme_, d1gvmf_