Lineage for d1gvda_ (1gvd A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761366Family a.4.1.3: Myb/SANT domain [46739] (15 proteins)
  6. 761374Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 761375Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 761376Domain d1gvda_: 1gvd A: [83338]
    repeat 2
    complexed with nh4, so4; mutant

Details for d1gvda_

PDB Entry: 1gvd (more details), 1.45 Å

PDB Description: crystal structure of c-myb r2 v103l mutant
PDB Compounds: (A:) Myb proto-oncogene protein

SCOP Domain Sequences for d1gvda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
likgpwtkeedqrliklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe

SCOP Domain Coordinates for d1gvda_:

Click to download the PDB-style file with coordinates for d1gvda_.
(The format of our PDB-style files is described here.)

Timeline for d1gvda_: