SCOPe 2.08: Domain d1guza2: 1guz A:143-305

Lineage for d1guza2 (1guz A:143-305)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
unusual fold, defines family
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
automatically mapped to Pfam PF02866
Protein Malate dehydrogenase [56329] (12 species)
Species Chlorobium vibrioforme [TaxId:1098] [69842] (2 PDB entries)
Domain d1guza2: 1guz A:143-305 [65587]
Other proteins in same PDB: d1guza1, d1guzb1, d1guzc1, d1guzd1
complexed with nad

Details for d1guza2

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1guza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]}
agvldaarfrsfiamelgvsmqdinacvlgghgdamvpvvkyttvagipisdllpaetid
klvertrnggaeivehlkqgsafyapassvvemvesivldrkrvlpcavglegqygidkt
fvgvpvklgrngveqiyeinldqadldllqksakivdenckml

SCOPe Domain Coordinates for d1guza2:

Click to download the PDB-style file with coordinates for d1guza2.
(The format of our PDB-style files is described here.)

Timeline for d1guza2: