Lineage for d1guqa2 (1guq A:178-348)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929896Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
    duplication: consists of 2 HIT-like motifs
    binds zinc and iron ions
  6. 2929897Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species)
  7. 2929898Species Escherichia coli [TaxId:562] [54209] (4 PDB entries)
  8. 2929900Domain d1guqa2: 1guq A:178-348 [37523]
    complexed with fe, k, upg, zn

Details for d1guqa2

PDB Entry: 1guq (more details), 1.8 Å

PDB Description: structure of nucleotidyltransferase complexed with udp-glucose
PDB Compounds: (A:) galactose-1-phosphate uridylyltransferase

SCOPe Domain Sequences for d1guqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]}
eaeredrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllp
kahvlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlha
hfyppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv

SCOPe Domain Coordinates for d1guqa2:

Click to download the PDB-style file with coordinates for d1guqa2.
(The format of our PDB-style files is described here.)

Timeline for d1guqa2: