Lineage for d1guda_ (1gud A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. Protein D-allose-binding protein [53828] (1 species)
  7. Species Escherichia coli [TaxId:562] [53829] (3 PDB entries)
  8. Domain d1guda_: 1gud A: [83326]
    complexed with zn

Details for d1guda_

PDB Entry: 1gud (more details), 1.7 Å

PDB Description: hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations
PDB Compounds: (A:) d-allose-binding periplasmic protein

SCOPe Domain Sequences for d1guda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]}
aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq

SCOPe Domain Coordinates for d1guda_ are not available.

Timeline for d1guda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gudb_