Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
Protein 2,4-dienoyl-CoA reductase [89517] (1 species) |
Species Yeast (Candida tropicalis) [TaxId:5482] [89518] (6 PDB entries) |
Domain d1gu7a2: 1gu7 A:161-349 [83322] Other proteins in same PDB: d1gu7a1, d1gu7b1 complexed with gol, so4 |
PDB Entry: 1gu7 (more details), 1.7 Å
SCOPe Domain Sequences for d1gu7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} ltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisv irdrpnldevvaslkelgatqvitedqnnsrefgptikewikqsggeaklalncvggkss tgiarklnnnglmltyggmsfqpvtiptslyifknftsagfwvtellknnkelktstlnq iiawyeegk
Timeline for d1gu7a2: